PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000626G0430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family HSF
Protein Properties Length: 401aa    MW: 45461.2 Da    PI: 8.0867
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000626G0430genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind742.7e-23329387260
                      HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
     HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 
                      Fl+k+y+++ d++++e isws++g sfvv+d++ f++++L+++Fkhsnf+SF+RQLn+Y
  PH01000626G0430 329 FLTKVYDMVLDPTTEEAISWSDDGASFVVWDSHAFERDLLSRHFKHSNFTSFIRQLNTY 387
                      9*********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.40.201.1E-22129188No hitNo description
SuperFamilySSF506921.88E-11144188IPR009010Aspartate decarboxylase-like domain
PfamPF023591.1E-6148186IPR003338CDC48, N-terminal subdomain
Gene3DG3DSA:2.40.40.208.2E-19189241No hitNo description
SuperFamilySSF506927.83E-7203241IPR009010Aspartate decarboxylase-like domain
Gene3DG3DSA:1.10.10.102.1E-24322387IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467857.62E-20325388IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004158.9E-17325400IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004472.7E-19329387IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.5E-10329352IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.5E-10367379IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.5E-10380392IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MPLNYSLSSP LPSHAALPLP LPDAAVLPHP RAAPSRTAPT HVSQLLTLRR NNTHQQRPRR  60
SLPPPRALRL RPPPREDSPW RAKASPQPPP IHEIPPPPQS DLAASRVFGS DLVFGGIFGD  120
FFLLWGWYRK GKKDYSTVIL ERKKSPNRLV VDEATNDDNS IVALHPDTME RLQLFRGDTV  180
LLKGWCRKGK KDYSTTILER KKSPNWLVVD EATSDDNFVI ALHPDTMERL QLFRDDTVLL  240
KIGDSICYGC CELEFVDLRY RSVGKAVPLL PYLLAEVWDN MESIDFARNF KERPMGIARA  300
IANLQCREEN APELTPVAVV PKALEVAPFL TKVYDMVLDP TTEEAISWSD DGASFVVWDS  360
HAFERDLLSR HFKHSNFTSF IRQLNTYVRF PHHLCFLVCS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3hu2_A1e-131262844126Transitional endoplasmic reticulum ATPase
3hu2_B1e-131262844126Transitional endoplasmic reticulum ATPase
3hu2_C1e-131262844126Transitional endoplasmic reticulum ATPase
3hu2_D1e-131262844126Transitional endoplasmic reticulum ATPase
3hu2_E1e-131262844126Transitional endoplasmic reticulum ATPase
3hu2_F1e-131262844126Transitional endoplasmic reticulum ATPase
3qq7_A3e-141262843125Transitional endoplasmic reticulum ATPase
3qq8_A3e-141262843125Transitional endoplasmic reticulum ATPase
3qwz_A5e-14123188468Transitional endoplasmic reticulum ATPase
3tiw_A3e-1413428411126Transitional endoplasmic reticulum ATPase
3tiw_B3e-1413428411126Transitional endoplasmic reticulum ATPase
5d5w_B6e-15327387262Putative transcription factor
5d5x_B6e-15327387262Putative transcription factor
5d5x_E6e-15327387262Putative transcription factor
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0875441e-67AC087544.2 Oryza sativa Japonica Group cultivar japonica chromosome 10 clone nbxb0046P18, complete sequence.
GenBankAP0149661e-67AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
GenBankCP0126181e-67CP012618.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 10 sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12137394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51910.14e-22heat shock transcription factor A7A